Protein Info for Ac3H11_674 in Acidovorax sp. GW101-3H11

Annotation: TsaC protein (YrdC domain) required for threonylcarbamoyladenosine t(6)A37 modification in tRNA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 338 TIGR00057: tRNA threonylcarbamoyl adenosine modification protein, Sua5/YciO/YrdC/YwlC family" amino acids 7 to 213 (207 residues), 154.4 bits, see alignment E=1.1e-49 PF01300: Sua5_yciO_yrdC" amino acids 17 to 204 (188 residues), 178.9 bits, see alignment E=7e-57 PF03481: Sua5_C" amino acids 206 to 337 (132 residues), 81.8 bits, see alignment E=6.8e-27

Best Hits

KEGG orthology group: K07566, putative translation factor (inferred from 80% identity to vei:Veis_1544)

Predicted SEED Role

"TsaC protein (YrdC domain) required for threonylcarbamoyladenosine t(6)A37 modification in tRNA"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165JW95 at UniProt or InterPro

Protein Sequence (338 amino acids)

>Ac3H11_674 TsaC protein (YrdC domain) required for threonylcarbamoyladenosine t(6)A37 modification in tRNA (Acidovorax sp. GW101-3H11)
MILDGNDPSAIAAAARAVRSGALLGLPTETVYGLAADASSDAAVAQIFAAKGRPSDHPLI
VHVANAQGIAHFASEVPGFAQKLVDAFWPGPLTLILPRLPGVATAATGGQDSVGLRCPAH
PVAHALLEACAAPADGTDQGGPPVWGVAAPSANRFGRVSPTTAQHVQDELGTDLLVLDGG
PCGVGIESTIVDCTRGVPVLLRPGAITRAQIAAACGIAPLSKEDLPALTPRASGTLEAHY
APAAKVRLMDAKALQTSLDLLGADAAHIAVYARSALRSHSSRLVLRRMPDDAAATAQQLF
AVLRGFDDEGVKLIWIETPPASPDWEGVRDRLQRAAAA