Protein Info for Ac3H11_4985 in Acidovorax sp. GW101-3H11

Annotation: Branched-chain amino acid transport system permease protein LivM (TC 3.A.1.4.1)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 345 transmembrane" amino acids 24 to 65 (42 residues), see Phobius details amino acids 67 to 87 (21 residues), see Phobius details amino acids 97 to 117 (21 residues), see Phobius details amino acids 124 to 145 (22 residues), see Phobius details amino acids 172 to 191 (20 residues), see Phobius details amino acids 221 to 241 (21 residues), see Phobius details amino acids 253 to 280 (28 residues), see Phobius details amino acids 300 to 322 (23 residues), see Phobius details PF02653: BPD_transp_2" amino acids 46 to 318 (273 residues), 117.4 bits, see alignment E=3.4e-38

Best Hits

KEGG orthology group: K01998, branched-chain amino acid transport system permease protein (inferred from 90% identity to rfr:Rfer_4064)

Predicted SEED Role

"Branched-chain amino acid transport system permease protein LivM (TC 3.A.1.4.1)" in subsystem ABC transporter branched-chain amino acid (TC 3.A.1.4.1) (TC 3.A.1.4.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165JIX5 at UniProt or InterPro

Protein Sequence (345 amino acids)

>Ac3H11_4985 Branched-chain amino acid transport system permease protein LivM (TC 3.A.1.4.1) (Acidovorax sp. GW101-3H11)
MRIGTLKETYIADAALFDSRTQKVWLAVGAALLVLFPFMASDYWLYLACLVSINVASATG
LNILTGYTGLVSLGQAAFMGLGAYTVAVLETKVGTPFVLNLLAGGFVAMLGGIVVGIPSL
RVKGLYLAIATIAASFIAHFIFANWKFTGGTGGLSVPPAKLFGMALDTSFRLYWLIVPVT
ILMLLGAANLFRTRVGRAFIAIRDRDISAEVLGIPLLRYKLLSFGLSSFYAGVAGGLWAY
FFRVVTPESFPLLMSIFFLAAIIVGGMGSILGGILGAVFMTMVPELLKLVVDLMPGGSEL
TVLLSPVRTVIFGLLIIGFLVFEPHGLAEVWRRVRRFFHLWPFRN