Protein Info for Ac3H11_4961 in Acidovorax sp. GW101-3H11

Annotation: NADPH:quinone oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 205 PF02525: Flavodoxin_2" amino acids 10 to 130 (121 residues), 40 bits, see alignment E=3.7e-14 PF03358: FMN_red" amino acids 10 to 164 (155 residues), 138.5 bits, see alignment E=1.4e-44

Best Hits

KEGG orthology group: None (inferred from 80% identity to vei:Veis_1062)

Predicted SEED Role

"NADPH:quinone oxidoreductase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165JIJ5 at UniProt or InterPro

Protein Sequence (205 amino acids)

>Ac3H11_4961 NADPH:quinone oxidoreductase (Acidovorax sp. GW101-3H11)
MPQTTTPSSLLVFAGSTRQQSFNRKLAHATAAIARDAGASVTLLELSDFDIPLYNADLEA
QGTPADVIRLKEVLWQHPAWVICSPEYNGSYTALLKNTIDWASSPVKGNPDWQDGGKSFR
GKVVGMLSASPGALGGLRSQSHLAPLLINAECWLAPKAFALGSAGSAFDDSGALIQQTHR
DRVRAVVDQVLWASARLNAEAATGQ