Protein Info for Ac3H11_4956 in Acidovorax sp. GW101-3H11

Annotation: tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 661 TIGR00136: tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA" amino acids 7 to 639 (633 residues), 881.1 bits, see alignment E=1.8e-269 PF00890: FAD_binding_2" amino acids 8 to 38 (31 residues), 21.3 bits, see alignment (E = 3.5e-08) PF01134: GIDA" amino acids 8 to 405 (398 residues), 562.3 bits, see alignment E=1.6e-172 PF12831: FAD_oxidored" amino acids 8 to 160 (153 residues), 40.6 bits, see alignment E=5.3e-14 PF21680: GIDA_C_1st" amino acids 468 to 574 (107 residues), 87.4 bits, see alignment E=2.2e-28 PF13932: GIDA_C" amino acids 579 to 634 (56 residues), 78.8 bits, see alignment 5.4e-26

Best Hits

Swiss-Prot: 92% identical to MNMG_ACIET: tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG (mnmG) from Acidovorax ebreus (strain TPSY)

KEGG orthology group: K03495, glucose inhibited division protein A (inferred from 92% identity to dia:Dtpsy_0045)

MetaCyc: 69% identical to 5-carboxymethylaminomethyluridine-tRNA synthase subunit MnmG (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165JIE4 at UniProt or InterPro

Protein Sequence (661 amino acids)

>Ac3H11_4956 tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA (Acidovorax sp. GW101-3H11)
MLYPQEFDVIVVGGGHAGTEAALAAARMGSKTLLLTHNIETLGQMSCNPSIGGIGKGHLV
KEVDALGGAMALATDEGGIQFRILNSSKGPAVRATRAQADRILYKAAIRRMLENQPNLWL
FQQAVDDLMVEGDRVVGAVTQVGIRFRSRTVVLTAGTFLDGKIHVGLNNYAAGRAGDPPA
VSLSARLKELKLPQGRLKTGTPPRIDGRSIDFSKCTEQPGDGMPGGVNEGTVPVFSFMGN
AQMHPQQVPCWITHTNERTHEIIRSGFDRSPMFTGKIEGVGPRYCPSVEDKINRFADKDS
HQIFLEPEGLTTHEFYPNGISTSLPFDIQYDLVRSMPGLENAHILRPGYAIEYDYFDPRS
LKSSFETRQIQGLFFAGQINGTTGYEEAAAQGLFAGINAALQCRGDAPWLPGRDEAYLGV
LVDDLITKGVTEPYRMFTSRAEFRLQLREDNADMRLTEVGRQMGLVDDARWDAFSRKRDA
VSRETERLKATWVNPRNLPAAESERVLGKSIEHEYNLFELLRRPDVGYANLMSMDGGKYA
SADVSRETLGDLSEPVVEQVEIAVKYAGYIDRQKGEVERAAHFEKLRLPPDLDYMQVTAL
SIEARQVLSRHRPETLGHASRITGITPASISLLMVHLKKGGFKEFAVVPATPAKAEGEVA
A