Protein Info for Ac3H11_4781 in Acidovorax sp. GW101-3H11

Annotation: Glutamyl-tRNA reductase (EC 1.2.1.70)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 443 transmembrane" amino acids 253 to 274 (22 residues), see Phobius details TIGR01035: glutamyl-tRNA reductase" amino acids 5 to 428 (424 residues), 357.1 bits, see alignment E=6.7e-111 PF05201: GlutR_N" amino acids 6 to 164 (159 residues), 152.6 bits, see alignment E=1.4e-48 PF01488: Shikimate_DH" amino acids 180 to 314 (135 residues), 151.5 bits, see alignment E=3.1e-48 PF00745: GlutR_dimer" amino acids 328 to 430 (103 residues), 66.7 bits, see alignment E=4e-22

Best Hits

Swiss-Prot: 90% identical to HEM1_ACIAC: Glutamyl-tRNA reductase (hemA) from Acidovorax citrulli (strain AAC00-1)

KEGG orthology group: K02492, glutamyl-tRNA reductase [EC: 1.2.1.70] (inferred from 90% identity to aaa:Acav_3581)

Predicted SEED Role

"Glutamyl-tRNA reductase (EC 1.2.1.70)" in subsystem Experimental tye or Heme and Siroheme Biosynthesis (EC 1.2.1.70)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.2.1.70

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A162F7T7 at UniProt or InterPro

Protein Sequence (443 amino acids)

>Ac3H11_4781 Glutamyl-tRNA reductase (EC 1.2.1.70) (Acidovorax sp. GW101-3H11)
MAVWALGINHTTAPLDLRGRFAFALDQIAPTLHGLRQSLGHSGGGASRHPGVETAIISTC
NRTEIYCAGDQPAMDHTLGWLAHSGGVSPALLRSHSYTLEDSLVARHAFRVASGLDSMVL
GEAQILGQMKDAVRAAETAGALGTTLNQLFQRSFAVAKEVRSSTEIGAHSISMAAAAVRL
AGQLFEDLSKIRVLFVGAGEMIELCATHFAAKNPKQIAIANRTLERGEKLATRFGGEVMR
LADLPERLHEFDAVISCTASSLPIIGLGAVERALKKRRHRPMFMVDLAVPRDIEPEVKAL
GDVYLYTVDDLATVVQTAQANRQAAVAQAEAIIDAGVQSFMHWMELRSPAAAEGGVVPLI
QQLNAQTDEWRALEIARAKKLLAKGEDVDAVLEALSRGLTQKMLHGTLAELRAGDAEVRA
QTAQTVSRLFLRAQSKTPHNNGL