Protein Info for Ac3H11_4747 in Acidovorax sp. GW101-3H11

Annotation: 4-hydroxythreonine-4-phosphate dehydrogenase (EC 1.1.1.262)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 342 TIGR00557: 4-hydroxythreonine-4-phosphate dehydrogenase PdxA" amino acids 4 to 340 (337 residues), 387 bits, see alignment E=4.1e-120 PF04166: PdxA" amino acids 32 to 337 (306 residues), 337.7 bits, see alignment E=3e-105

Best Hits

Swiss-Prot: 50% identical to PDXA_RHIME: 4-hydroxythreonine-4-phosphate dehydrogenase (pdxA) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K00097, 4-hydroxythreonine-4-phosphate dehydrogenase [EC: 1.1.1.262] (inferred from 85% identity to vei:Veis_3936)

Predicted SEED Role

"4-hydroxythreonine-4-phosphate dehydrogenase (EC 1.1.1.262)" in subsystem Pyridoxin (Vitamin B6) Biosynthesis (EC 1.1.1.262)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.262

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A162F7R2 at UniProt or InterPro

Protein Sequence (342 amino acids)

>Ac3H11_4747 4-hydroxythreonine-4-phosphate dehydrogenase (EC 1.1.1.262) (Acidovorax sp. GW101-3H11)
MHTIAITQGDPAGIGPEIVAKAFRDAPELLRHCFVVGDVATLRRAAQAIARPGVGGLPVA
QISAPHEALAMPPRCVPVLPVPGIPGPQPWGQVSAAAGRAAAGAVVWAARAALRGEVAAL
VTAPLHKEALSAAGVDFPGHTELLQAEAAAHQGVPLARMPVRMMLANDELRTVLVSIHVS
LRDAIAAVTQDNVLQTLQITHAALQRSLGRVPRMAVAGLNPHAGEGGLFGREELEVIAPA
IAAARAQGLDVHGPFAPDTVFMRARSTPQRAGEFDVVIAMYHDQGLIPVKYLGVDKGVNV
TLGLPLVRTSPDHGTAFDIAGQGVADAASLIEAVRMARQLSV