Protein Info for Ac3H11_4703 in Acidovorax sp. GW101-3H11

Annotation: Type IV pilus biogenesis protein PilQ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 711 signal peptide" amino acids 1 to 33 (33 residues), see Phobius details PF11741: AMIN" amino acids 48 to 130 (83 residues), 32.5 bits, see alignment E=1.2e-11 amino acids 161 to 264 (104 residues), 93.2 bits, see alignment E=1.4e-30 TIGR02515: type IV pilus secretin PilQ" amino acids 275 to 704 (430 residues), 493.4 bits, see alignment E=3.2e-152 PF03958: Secretin_N" amino acids 373 to 445 (73 residues), 40.5 bits, see alignment E=3.9e-14 PF00263: Secretin" amino acids 550 to 704 (155 residues), 152.1 bits, see alignment E=1.7e-48

Best Hits

KEGG orthology group: K02666, type IV pilus assembly protein PilQ (inferred from 80% identity to vei:Veis_0018)

Predicted SEED Role

"Type IV pilus biogenesis protein PilQ" in subsystem Type IV pilus

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (711 amino acids)

>Ac3H11_4703 Type IV pilus biogenesis protein PilQ (Acidovorax sp. GW101-3H11)
MKHRSGFFVNYCRIAAVGVSIAVISLGATAQGAINSISASIQGGVEVLRVDFDEPLAVAP
TGFSTQSPARVALDFQGVGNATGKSVYEVNLGNLKSVNVVQAGERSRIVLNLKSATSYRT
DIQGKTLILSLESVAGTASGVAPSIVHFSDSQNGDVLPLKDVDFRRGADGSGRVVVNLAN
NQVGVDLQQQSKGIVVEFMRSSLPEGIRRRLDVTDFGTPVQAVTASQIGERVRMLIESAG
DWEHSAYQSDSQFVVEIRQKKVDLSKLTQGPGYSGEKLSLNFQNIEVRSLLQVIADFTNF
NIVTSDTVTGALTLRLKDVPWDQALQIIMDAKGLGMKKTGSVLWIAPKDEIDARTKKDFE
AAQAIQKLEPLKTQAYQLNYAKAGDILTQLTTSPTSGGGVGTRFLSERGSAISEPRTNQL
FVTDTPSKLEEVRLLLASLDVAVRQVLIEARIVEARDSFGRSLGVRLGGSDLRANRGGDG
GYGIGGNNRVAFGSSYSDAVASSGAGGTTNTNGNFVNLPASLSNVSSVGSFALSIFNSAA
NRFLTLELSAMEADGKGRIVSSPRIITADQTKAVIEQGTEYPYAVTAPNGATTLAFKKAV
LKLEVTPQITPEGNIILDLDVNKDSRGETTQQGVAIDTKHVKTQILIENGGTVVIGGIFE
MEETNQESKIXLIGDVPVVGNLFKNRTKESTKREMLVFITPKVLSDKASAK