Protein Info for Ac3H11_4432 in Acidovorax sp. GW101-3H11

Annotation: Nitrogen regulation protein NR(I)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 547 TIGR01818: nitrogen regulation protein NR(I)" amino acids 4 to 391 (388 residues), 620.7 bits, see alignment E=8.1e-191 PF00072: Response_reg" amino acids 4 to 121 (118 residues), 81.8 bits, see alignment E=1e-26 PF14532: Sigma54_activ_2" amino acids 145 to 315 (171 residues), 87.4 bits, see alignment E=2.7e-28 PF00158: Sigma54_activat" amino acids 145 to 310 (166 residues), 235.9 bits, see alignment E=5.3e-74 PF07728: AAA_5" amino acids 168 to 287 (120 residues), 30.1 bits, see alignment E=1.1e-10 PF02954: HTH_8" amino acids 500 to 538 (39 residues), 39 bits, see alignment 1.4e-13

Best Hits

KEGG orthology group: K07712, two-component system, NtrC family, nitrogen regulation response regulator GlnG (inferred from 80% identity to vap:Vapar_1635)

Predicted SEED Role

"Nitrogen regulation protein NR(I)" in subsystem Ammonia assimilation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165LL62 at UniProt or InterPro

Protein Sequence (547 amino acids)

>Ac3H11_4432 Nitrogen regulation protein NR(I) (Acidovorax sp. GW101-3H11)
MKPIWIVDDDPSIRFVLEKALARENLPTRSFTHPREVLDALADVTAGDPARQGPQVLVSD
IRMPGGSGLQLLEKVRELQPGLPVIIMTAYSDLDSAVSAFQRGAFEYLPKPFDLPKAVEL
IRRAVEESQREEVTEERQTATPEMLGQAPAMQDVFRAIGRLSQSQVTVLITGESGSGKEL
VARALHKHSPVADGPFVAINTAAIPKDLLESELFGHERGAFTGAQTQRRGRFEQAEGGTL
FLDEIGDMPFDLQTRLLRVLSDGQFYRVGGHAAVKAHVRVIAATHQNLEQRVKEGGFRED
LFHRLNVIRLRLPALRERHEDVPMLTRHFLQQSARQLGVEPKRIADSALARLEQFAFPGN
VRQLENICHWLTVMAPAQVISLQDLPPEVLEAPVYQPPLRATPGAEPAATVTSMPVAPLA
AVVPVAQAAAAPLPPSDMVGGLHPAAPVPASMPAAVPSWSADAAAVAPAAAVHSWEQALE
TEAQKLLAGGQPEVWDALTRRFESRLIRTALVATHGRRMEAAQRLGIGRNTITRKIQELG
LDAPDEA