Protein Info for Ac3H11_4410 in Acidovorax sp. GW101-3H11

Annotation: Uncharacterized protein with LysM domain, COG1652

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 410 signal peptide" amino acids 1 to 37 (37 residues), see Phobius details PF01476: LysM" amino acids 70 to 116 (47 residues), 36 bits, see alignment 2.7e-13

Best Hits

KEGG orthology group: None (inferred from 71% identity to aaa:Acav_4626)

Predicted SEED Role

"Uncharacterized protein with LysM domain, COG1652" in subsystem Conserved gene cluster associated with Met-tRNA formyltransferase

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165K5G7 at UniProt or InterPro

Protein Sequence (410 amino acids)

>Ac3H11_4410 Uncharacterized protein with LysM domain, COG1652 (Acidovorax sp. GW101-3H11)
MHEKRNNMTAFTSVRRTALGALTIIAGALLVMPAQAQNYPISSGQRATAQQVSERGVPLE
ELAPNAPDTYTVKRGDTLWGISGMYLKRPWRWPELWGMNLKAIPNPHLIFPGQTLYLEKD
GGYARLRTSRPGAASEPETVRVSPRTRSDSLADSALPTLKPHLIEPFLVEPLVVDEQTLL
RAPRVIATTDERVLMGAGDRVYVRGDTASPMLAEAGEPRFYRVFRNAVALKDPMTGEVLG
YEAQYVGKAELVRGESFEETPNGKGGYNAEYVPATVDLSATKEEVQAGDRLLPAPARAFM
SYTPRAPEVEVDARVVSIYGSSAVAYGAQNQVVAINMGSEDGVEPGHVLSLMTKGDRIKD
TTDKAKATVKLPSEINGTAMVFRTFERVSYALLLEIRNGVRVGDRLVNPK