Protein Info for Ac3H11_4371 in Acidovorax sp. GW101-3H11

Annotation: LysR family transcriptional regulator YbhD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 306 PF00126: HTH_1" amino acids 7 to 66 (60 residues), 79.9 bits, see alignment E=1e-26 PF03466: LysR_substrate" amino acids 93 to 294 (202 residues), 156.2 bits, see alignment E=8.1e-50

Best Hits

Swiss-Prot: 42% identical to YBHD_ECOLI: Uncharacterized HTH-type transcriptional regulator YbhD (ybhD) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 95% identity to adn:Alide_4299)

Predicted SEED Role

"LysR family transcriptional regulator YbhD" in subsystem DNA-binding regulatory proteins, strays

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165K4K6 at UniProt or InterPro

Protein Sequence (306 amino acids)

>Ac3H11_4371 LysR family transcriptional regulator YbhD (Acidovorax sp. GW101-3H11)
MNNKFDLADIQAFAAVAELHSFRAAAESIHLSQPAFSRRIDKLEEALGVRLLDRTTRRVT
LTAVGRDFARKTRVWLDDLDGMLMGLGDVAARRMGEVTIACVPSAVYYFLPQVVKRYHER
FPKIRVKVHDASANEVLVAVAQGDADFGLNFIGSQEAEIEFKPVLAERFVAACRRDHVLA
RRKKVTWAELGQHDFMSVGKTSGNRLLMDLALANVPDRPQCLYEAKHVTTLLGLVEAGLG
VAAVPSLAMPGKDHPTLVSIPLVEPIVTRQMGLIKRRGKTLSPAAQQLYDLLVATRSVRP
RKATAA