Protein Info for Ac3H11_4264 in Acidovorax sp. GW101-3H11

Annotation: GTPase and tRNA-U34 5-formylation enzyme TrmE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 479 PF10396: TrmE_N" amino acids 9 to 135 (127 residues), 127.5 bits, see alignment E=6e-41 TIGR00450: tRNA modification GTPase TrmE" amino acids 13 to 479 (467 residues), 300.2 bits, see alignment E=3e-93 PF12631: MnmE_helical" amino acids 138 to 476 (339 residues), 201.2 bits, see alignment E=4.6e-63 TIGR00231: small GTP-binding protein domain" amino acids 231 to 324 (94 residues), 58.5 bits, see alignment E=7e-20 PF02421: FeoB_N" amino acids 233 to 289 (57 residues), 32 bits, see alignment 1.8e-11 PF01926: MMR_HSR1" amino acids 233 to 352 (120 residues), 81.1 bits, see alignment E=1.3e-26

Best Hits

Swiss-Prot: 82% identical to MNME_ACIAC: tRNA modification GTPase MnmE (mnmE) from Acidovorax citrulli (strain AAC00-1)

KEGG orthology group: K03650, tRNA modification GTPase (inferred from 82% identity to aav:Aave_4791)

Predicted SEED Role

"GTPase and tRNA-U34 5-formylation enzyme TrmE" in subsystem Universal GTPases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165K1S1 at UniProt or InterPro

Protein Sequence (479 amino acids)

>Ac3H11_4264 GTPase and tRNA-U34 5-formylation enzyme TrmE (Acidovorax sp. GW101-3H11)
MLPRHQDPIVAIATAPGRGAVGIVRVSGRAIGALVQALCGRALKPREATYLPFRDAQGQA
IDQGLALYFPGPHSYTGEDVLELQAHGGPVVLQLLLARCLEAGAATDPATGQPCLPGLRV
AQPGEFTERAFLNDKIDLAQAEAIADLIDASTEAAARSASRSLTGAFSAEIHGLRDALIH
LRMLVEATLDFPEEEIDFLRKADAHGQLSNLQQTLASVMQRARQGALLREGIKVVIAGQP
NAGKSSLLNALAGAELAIVTPIAGTTRDKVQQTIQIEGVPLHIIDTAGLRDSDDEVERIG
IARAWDEIAGADAVLFLHDLSRQDAMEYIASEADIARALAQKLPPTIPVIDVWNKLDRAP
GGAATAAEGAGHAETRPGVWLSARTGEGLDRLRRILLEVAGWQSAPEGLYIARARHIEAL
RAVSAHLQEAADQLQAQGPALDLLAEELRLAQNALSAITGEFSSDDLLGVIFSSFCIGK