Protein Info for Ac3H11_4259 in Acidovorax sp. GW101-3H11

Annotation: Chromosomal replication initiator protein DnaA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 474 PF11638: DnaA_N" amino acids 21 to 81 (61 residues), 67.2 bits, see alignment E=2.1e-22 TIGR00362: chromosomal replication initiator protein DnaA" amino acids 22 to 472 (451 residues), 558.2 bits, see alignment E=7.4e-172 PF00308: Bac_DnaA" amino acids 139 to 299 (161 residues), 207.8 bits, see alignment E=2.9e-65 PF00004: AAA" amino acids 176 to 297 (122 residues), 31.7 bits, see alignment E=5e-11 PF01695: IstB_IS21" amino acids 176 to 276 (101 residues), 28.4 bits, see alignment E=2.9e-10 PF08299: Bac_DnaA_C" amino acids 383 to 451 (69 residues), 112.3 bits, see alignment E=2.2e-36

Best Hits

Swiss-Prot: 72% identical to DNAA_METPP: Chromosomal replication initiator protein DnaA (dnaA) from Methylibium petroleiphilum (strain ATCC BAA-1232 / LMG 22953 / PM1)

KEGG orthology group: K02313, chromosomal replication initiator protein (inferred from 90% identity to ajs:Ajs_4144)

Predicted SEED Role

"Chromosomal replication initiator protein DnaA" in subsystem DNA-replication

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165K1N7 at UniProt or InterPro

Protein Sequence (474 amino acids)

>Ac3H11_4259 Chromosomal replication initiator protein DnaA (Acidovorax sp. GW101-3H11)
MTEEPTRSAQPSPGADAGQGLWQACVEQLAQDLPEQQFNTWIKPLVAQVAEDFSKVTLLV
ANRFKLDWIRAQYAGRIASLLEGLYGQPVSLELALAQRESVTRTYVRPASPEPSSAPAPA
ESPAASIDEAPAGAFRNRLNAALTFETLVEGTANRMARSAAMHVAGMPGHLYNPLFIYGG
VGLGKTHLMHAVGNRLLQDKPDAKVLYIHAEQFVSDVVKAYQRRTFDEFKERYHSLDLLL
IDDVQFFANKDRTQEEFFNAFEALLTKKSHIVMTSDTYPKGLTNIHDRLVSRFDSGLTVA
LEPPELEMRVAILINKARVEGTEMPEEVAFFVAKNVRSNVRELEGALRKILAYSRFNQKE
ISIQLAREALRDLLSIQNRQISVENIQKTVADYYKIKVADMYSKKRPASIARPRQIAMYL
AKELTQKSLPEIGELFGGRDHTTVLHAVRKISGERQQLTELNQQLHVLEQTLKG