Protein Info for Ac3H11_4059 in Acidovorax sp. GW101-3H11

Annotation: Lipid A export ATP-binding/permease protein MsbA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 768 transmembrane" amino acids 182 to 203 (22 residues), see Phobius details amino acids 224 to 245 (22 residues), see Phobius details amino acids 298 to 321 (24 residues), see Phobius details amino acids 327 to 346 (20 residues), see Phobius details amino acids 411 to 434 (24 residues), see Phobius details amino acids 440 to 457 (18 residues), see Phobius details PF00664: ABC_membrane" amino acids 184 to 457 (274 residues), 155.6 bits, see alignment E=2.2e-49 PF00005: ABC_tran" amino acids 521 to 669 (149 residues), 113 bits, see alignment E=1.8e-36

Best Hits

KEGG orthology group: K06147, ATP-binding cassette, subfamily B, bacterial (inferred from 83% identity to adn:Alide_0783)

Predicted SEED Role

"Lipid A export ATP-binding/permease protein MsbA" in subsystem ZZ gjo need homes

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165LZX6 at UniProt or InterPro

Protein Sequence (768 amino acids)

>Ac3H11_4059 Lipid A export ATP-binding/permease protein MsbA (Acidovorax sp. GW101-3H11)
MQHHHSVDASGVFSGPVGGELRAMLASKENVLAALQVDLSTALRFATGWVVVTSERLLAC
EPGTTAWRSWPLGDGLALRLHDHGGVGSLELHAPQERLALWRFTLAHHAQALRLVQRFDQ
QVARGGNAAEDEDDEPACPTCHTPLPPDTEECPACARAQPLQTSTWVLLRLWRFARPYRK
QLATGFALTLASTAATLVPPYLTIPLMDDILIPFQNGQKIEPGLVMLYLSGLLLSALAAW
GLSWARTYILALVSERIGADLRTTTYEHLLRLSLDYFGGKRTGDLMARIGSETDRINVFL
SLHALDFVTDVLMIMMTAAILFSINPWLALVTLVPLPFIGWMIHTVRDRLRTGFEKIDRV
WSEVTNVLADTIPGIRVVKAFAQEKREAQRFRDANQHNLEVNDKLNKTWSLFTPTVSLLT
EIGLLVVWAFGIWLVSRNQITVGVLTAFIAYIGRFYGRLDSMSRIVSVTQKAAAGAKRIF
DILDHVSNVPDPAQPVKVDKVQGAISMQGVGFRYGSRAVIKGLHLDIRPGEMIGLVGHSG
SGKSTLVNLISRFYDVSDGSIQVDGIDIRRFAVADYRRHIGLVLQEPFLFFGTIAENIAY
GKPEATREEIVAAARAAHAHEFILRLPHGYDSLVGERGQGLSGGERQRISIARALLIDPR
ILILDEATSAVDTETEKEIQKALDNLVQGRTTIAIAHRLSTLRKADRLVVMDRGEVVEVG
PHDELMEKQGAYWRLYEAQARRAEEDAQAAGVIIDSSLLHPAHPAGNP