Protein Info for Ac3H11_4044 in Acidovorax sp. GW101-3H11

Annotation: Shikimate 5-dehydrogenase I alpha (EC 1.1.1.25)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 284 TIGR00507: shikimate dehydrogenase" amino acids 10 to 278 (269 residues), 230.6 bits, see alignment E=9.8e-73 PF08501: Shikimate_dh_N" amino acids 13 to 95 (83 residues), 71.9 bits, see alignment E=6.5e-24 PF01488: Shikimate_DH" amino acids 125 to 204 (80 residues), 43.6 bits, see alignment E=4.8e-15 PF18317: SDH_C" amino acids 249 to 276 (28 residues), 37.3 bits, see alignment (E = 2.7e-13)

Best Hits

Swiss-Prot: 80% identical to AROE_VEREI: Shikimate dehydrogenase (NADP(+)) (aroE) from Verminephrobacter eiseniae (strain EF01-2)

KEGG orthology group: K00014, shikimate dehydrogenase [EC: 1.1.1.25] (inferred from 80% identity to vei:Veis_2197)

Predicted SEED Role

"Shikimate 5-dehydrogenase I alpha (EC 1.1.1.25)" in subsystem Chorismate Synthesis or Common Pathway For Synthesis of Aromatic Compounds (DAHP synthase to chorismate) (EC 1.1.1.25)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.25

Use Curated BLAST to search for 1.1.1.25

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165LZL2 at UniProt or InterPro

Protein Sequence (284 amino acids)

>Ac3H11_4044 Shikimate 5-dehydrogenase I alpha (EC 1.1.1.25) (Acidovorax sp. GW101-3H11)
MTSSSLPADLYCVMGNPVAHSRSPAIHARFAELTGEPIAYERRLVPMDGFAQGVRDFVAE
GGRGCNVTVPFKTDAPGLATACSERVQLAGAANTLTFRADGSIYADNTDGLGLVADITHN
AGVPLAGRDVLLVGAGGAAAGVLGPLLLAGARHITVANRTLAKAQALVESHRPLALLQKA
ELEALEPSAVTANFDVIINATASSLAGAGVPVPASVLRPGALAYDMMYGPAAQEFLDWAR
SHGAVPRDGLGMLVEQAAEAFLLWRGVRPPSAQVLHEMQPSATA