Protein Info for Ac3H11_4027 in Acidovorax sp. GW101-3H11

Annotation: Ribosomal protein L11 methyltransferase (EC 2.1.1.-)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 301 TIGR00406: ribosomal protein L11 methyltransferase" amino acids 2 to 287 (286 residues), 201.3 bits, see alignment E=1.2e-63 PF06325: PrmA" amino acids 2 to 301 (300 residues), 265.4 bits, see alignment E=1.8e-82 PF13489: Methyltransf_23" amino acids 153 to 271 (119 residues), 36 bits, see alignment E=1.4e-12 PF05175: MTS" amino acids 172 to 220 (49 residues), 34.8 bits, see alignment 3.2e-12 PF13649: Methyltransf_25" amino acids 175 to 222 (48 residues), 29.1 bits, see alignment 3.3e-10

Best Hits

Swiss-Prot: 75% identical to PRMA_POLSJ: Ribosomal protein L11 methyltransferase (prmA) from Polaromonas sp. (strain JS666 / ATCC BAA-500)

KEGG orthology group: K02687, ribosomal protein L11 methyltransferase [EC: 2.1.1.-] (inferred from 80% identity to dia:Dtpsy_2947)

Predicted SEED Role

"Ribosomal protein L11 methyltransferase (EC 2.1.1.-)" in subsystem Heat shock dnaK gene cluster extended or Ribosome biogenesis bacterial (EC 2.1.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165LZ55 at UniProt or InterPro

Protein Sequence (301 amino acids)

>Ac3H11_4027 Ribosomal protein L11 methyltransferase (EC 2.1.1.-) (Acidovorax sp. GW101-3H11)
MFELSLMCPEDCIEPVSDALDALDALSVSVEDADAQTDAEQALFGEPGMPPPKDGWQRSR
VVALFPSEVAAREAQQLLVVQDFFVGCQVLGVAQVAEQDWVRLTQSQFAPVDITPDFWIV
PTWHELPAQAVRSIRLDPGLAFGTGTHPTTRMCLRWIARNGAVQPGAGNNPLGRVLDYGC
GSGILAIGAAKFGATDIDAVDIDPAAVESTAQNAQANGVQLSAGLPDKARGEYQTVLANI
LATPLRVLAPLLCAHVAPGGHLVLAGILERQADELKEAYAPWVRLEVADAEDGWILMTAQ
R