Protein Info for Ac3H11_4024 in Acidovorax sp. GW101-3H11

Annotation: Sugar kinases, ribokinase family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00294: PfkB
  • amino acids 36 to 290 (255 residues), 129.8 bits, E=7e-42

Best Hits

Swiss-Prot: 37% identical to ADOK_MYCBO: Adenosine kinase (adoK) from Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)

KEGG orthology group: K00856, adenosine kinase [EC: 2.7.1.20] (inferred from 84% identity to vei:Veis_1493)

Predicted SEED Role

"Sugar kinases, ribokinase family"

MetaCyc Pathways

• superpathway of purine nucleotide salvage (12/14 steps found)
• adenine and adenosine salvage VI (1/1 steps found)

KEGG Metabolic Maps

• Purine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.20

Sequence Analysis Tools

See A0A165LZ35 at UniProt or InterPro

Protein Sequence (298 amino acids)

>Ac3H11_4024 Sugar kinases, ribokinase family (Acidovorax sp. GW101-3H11)
MAALICGSLAFDTIMTFEGRFAEQILPDQLHILNVSFLVPSLRRDFGGCAGNIAYSLKLL
GGEPLPMAMLGSDGADYLQRLESLDIDCRHVGQVQDTYTAQAMIMTDRDNNQITAFHPGA
MMQAHANRIDVGAKASVGIIAPDGRDAMLEHAAQFVAAGIPFVFDPGQGLPMFSGEELAK
FIDQASWVTVNDYEGKMLSDRTGWTLAEISRKVEGLVVTLGAEGCEVWVAGEKTHVPAVV
PTQVVDPTGCGDAWRGALLFGLERGWALPRCAALGNRVGALKIAQRGPQNYTLDFAVE