Protein Info for Ac3H11_3906 in Acidovorax sp. GW101-3H11

Annotation: putative iron-regulated membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 380 transmembrane" amino acids 12 to 37 (26 residues), see Phobius details amino acids 139 to 160 (22 residues), see Phobius details amino acids 188 to 209 (22 residues), see Phobius details amino acids 335 to 356 (22 residues), see Phobius details PF03929: PepSY_TM" amino acids 11 to 356 (346 residues), 203.2 bits, see alignment E=4.1e-64

Best Hits

KEGG orthology group: None (inferred from 73% identity to vei:Veis_3639)

Predicted SEED Role

"putative iron-regulated membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165LWC3 at UniProt or InterPro

Protein Sequence (380 amino acids)

>Ac3H11_3906 putative iron-regulated membrane protein (Acidovorax sp. GW101-3H11)
MTSQRTLNRLFTLHSWAGIVTGLLMFIVCFSGAVVVFKNEIDLWANPSLAQLPRSEHPAS
LDAVMVQLQTRYPGATVETIALPDAVNPSYFAFIRERGAPASTRTKVALRSDTGTVVGPV
DSQLGQYLRMLHVFLFFGPRWIVGFLGAAMLVLIATGIVIHRKILAELFTQRWGRSFRVV
MSDLHKSAGIWGLGFHILIAATGAWMGLAPLFEQGYKYLTTPATLTATKPARKAEASEPV
PMQSLDALYATAQQAVPGLEARYVSLRRWGSSTAEVGFTGNLRDHLASTARVDTNAATGV
AKKVHDPRTAGFWSLVNSLMEPLHFGDFGGLALKWLYFFLGMTPALLSISGTLIWLDARQ
QRRREAEAALGAAGSVAAAG