Protein Info for Ac3H11_3898 in Acidovorax sp. GW101-3H11

Annotation: Acyl dehydratase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 154 PF13452: MaoC_dehydrat_N" amino acids 13 to 136 (124 residues), 26.4 bits, see alignment E=6.7e-10 PF01575: MaoC_dehydratas" amino acids 13 to 118 (106 residues), 104.8 bits, see alignment E=2.3e-34

Best Hits

Swiss-Prot: 58% identical to ECH1_MYCBO: Probable enoyl-CoA hydratase 1 (BQ2027_MB0135) from Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)

KEGG orthology group: None (inferred from 86% identity to vei:Veis_0438)

MetaCyc: 57% identical to 4-chloro-3-hydroxybutyryl-CoA dehydratase (Salinispora tropica)
4.2.1.-

Predicted SEED Role

"Acyl dehydratase"

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165LW54 at UniProt or InterPro

Protein Sequence (154 amino acids)

>Ac3H11_3898 Acyl dehydratase (Acidovorax sp. GW101-3H11)
MKIFRSYSEVSACVGQEVAVTDWITITQEQVNLFAQATGDHQWIHVDPERAKAGPFGAPI
AHGFLTLSLIPQFFETGLTIEGARMGVNYGLNKVRFTAPVPVGSRLRARLTLQAAEPVAP
DGMQMTWLVTVEREGSDKPVCVAESLARNFGAPA