Protein Info for Ac3H11_3886 in Acidovorax sp. GW101-3H11

Annotation: Cytochrome oxidase biogenesis protein Surf1, facilitates heme A insertion

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 268 transmembrane" amino acids 12 to 31 (20 residues), see Phobius details amino acids 105 to 124 (20 residues), see Phobius details amino acids 235 to 253 (19 residues), see Phobius details PF02104: SURF1" amino acids 23 to 243 (221 residues), 130.4 bits, see alignment E=6e-42

Best Hits

KEGG orthology group: None (inferred from 64% identity to aav:Aave_3902)

Predicted SEED Role

"Cytochrome oxidase biogenesis protein Surf1, facilitates heme A insertion" in subsystem Biogenesis of cytochrome c oxidases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165LVW7 at UniProt or InterPro

Protein Sequence (268 amino acids)

>Ac3H11_3886 Cytochrome oxidase biogenesis protein Surf1, facilitates heme A insertion (Acidovorax sp. GW101-3H11)
VTTIRRPLGLRFWLITLATVAGMLVTASLGRWQLSRAAQKEALQAMLDARGRMPAMDGRV
LLSQPAMATTEAETLVHRAVVLEGRWVPEHTVYLDNRQMNGRPGFFVLTPLQLVGTPSGV
VLVQRGWVPRNFQDRTQLPQVPTPQDVVVRVAGRVAAAPSRLYEFGGGESSAGGHGAEGS
SRIRQNLDLAAFRTETGLALAPLTVVQTGEAVGAGDGLQRDWPVVGAGVDKHYGYAFQWF
GLSGLMALLYVWFQIVRRFIRPRSQPAP