Protein Info for Ac3H11_3884 in Acidovorax sp. GW101-3H11

Annotation: Heme A synthase, cytochrome oxidase biogenesis protein Cox15-CtaA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 394 transmembrane" amino acids 12 to 33 (22 residues), see Phobius details amino acids 45 to 65 (21 residues), see Phobius details amino acids 115 to 136 (22 residues), see Phobius details amino acids 154 to 173 (20 residues), see Phobius details amino acids 179 to 202 (24 residues), see Phobius details amino acids 223 to 242 (20 residues), see Phobius details amino acids 295 to 313 (19 residues), see Phobius details amino acids 326 to 345 (20 residues), see Phobius details amino acids 351 to 371 (21 residues), see Phobius details PF02628: COX15-CtaA" amino acids 47 to 366 (320 residues), 253 bits, see alignment E=1.9e-79

Best Hits

KEGG orthology group: K02259, cytochrome c oxidase subunit XV assembly protein (inferred from 78% identity to vei:Veis_1387)

Predicted SEED Role

"Heme A synthase, cytochrome oxidase biogenesis protein Cox15-CtaA" in subsystem Biogenesis of cytochrome c oxidases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165LVV1 at UniProt or InterPro

Protein Sequence (394 amino acids)

>Ac3H11_3884 Heme A synthase, cytochrome oxidase biogenesis protein Cox15-CtaA (Acidovorax sp. GW101-3H11)
MSDTQPLYDLAPVLELMLLGLLIALGPLAWVWVRNRRSSPMRRLQALTVLTLFLTFDLVL
FGAFTRLTDSGLGCPDWPGCYGSASPVGARAEIAAAQEAMPTGPVTHGKAWVEMIHRYLA
TGVGVLIIVLTVSSWVQQRRALRGAAEAPPLSPWWPTVTLVWVCLQGAFGALTVTMKLFP
AIVTLHLIGGLVLLALLCVQAVRHTHAAQGRLPAVISPALRRGLAWAGLLLALQVVLGGW
VSTNYAVLACTTFPTCQGSWWPAMDFAQGFQVWRKLGMLQDGSHISFAGLTAIHYVHRLM
AYVVLAALAWLAWRLHRRGVLRAQTRWLAGLSVLQLATGLSNVILDWPLVAAVLHTGGAA
ALVVVLTWALVSSRATVPVSREFSAPPGASRVSA