Protein Info for Ac3H11_3568 in Acidovorax sp. GW101-3H11

Annotation: TRAP dicarboxylate transporter, DctM subunit, unknown substrate 6

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 594 transmembrane" amino acids 12 to 42 (31 residues), see Phobius details amino acids 60 to 81 (22 residues), see Phobius details amino acids 105 to 135 (31 residues), see Phobius details amino acids 147 to 171 (25 residues), see Phobius details amino acids 186 to 207 (22 residues), see Phobius details amino acids 230 to 249 (20 residues), see Phobius details amino acids 272 to 291 (20 residues), see Phobius details amino acids 306 to 329 (24 residues), see Phobius details amino acids 335 to 355 (21 residues), see Phobius details amino acids 367 to 387 (21 residues), see Phobius details amino acids 406 to 436 (31 residues), see Phobius details amino acids 445 to 473 (29 residues), see Phobius details amino acids 500 to 523 (24 residues), see Phobius details PF06808: DctM" amino acids 14 to 247 (234 residues), 171.8 bits, see alignment E=1.1e-54 amino acids 298 to 524 (227 residues), 155 bits, see alignment E=1.4e-49

Best Hits

KEGG orthology group: None (inferred from 80% identity to dac:Daci_2245)

Predicted SEED Role

"TRAP dicarboxylate transporter, DctM subunit, unknown substrate 6"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165J1P3 at UniProt or InterPro

Protein Sequence (594 amino acids)

>Ac3H11_3568 TRAP dicarboxylate transporter, DctM subunit, unknown substrate 6 (Acidovorax sp. GW101-3H11)
MEFLTHNLAPIMFAGLICFLLVGFPVAFSLGACGLFFAFIGIELNVLPEALLQAVPLRIF
GIMQNDTLLAIPFFTLMGLILERSGMAEDLLDTIGQLFGPIRGGLALAVIFVGALLAATT
GVVAASVISMGLISLPIMLRYGYDRRLAAGVIAASGTLAQIIPPSLVLIIIADQMGRSVG
DMYKGAFLPGLMLTGFYALYIILLAVFKPQWVPAIPPEARTLRGDDGKSGVPSLLVLTGI
CVAASIYVAKNMPALHSWWSGETVDKVALDETIVVSMCFGVALAFVAASINKITRMGLLS
RVAERVTFVLIPPLLLIFLVLGTIFLGVATPTEGGAMGALGAGIMAIIRGRLTLSLLKQA
ITTTTKLSCFVVFILVGATIFGLTFQGVDGPLWVEHLLTGLPGGQLGFLIVVNIMVFFLA
FFLDFFELSFIVVPLLAPVAHKLGIDLIWFGVLLAVNMQTSFMHPPFGFALFYLRSVAPA
KEYMDKVTKKMIAPVTTPQIYWGAIPFLCIQLLMVGLIIAFPGIVSSGLDKEVAYDLDKV
RMEMEATMPGEAAEAADPTAGMEGAAAAPGSDTAAPAADDPLKALQDSMANEKK