Protein Info for Ac3H11_3537 in Acidovorax sp. GW101-3H11

Annotation: TPR domain protein, putative component of TonB system

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 522 PF13432: TPR_16" amino acids 124 to 175 (52 residues), 23.8 bits, see alignment 4e-08 amino acids 329 to 368 (40 residues), 28.8 bits, see alignment 1.1e-09 amino acids 433 to 489 (57 residues), 21.1 bits, see alignment 2.9e-07 PF13174: TPR_6" amino acids 256 to 283 (28 residues), 13.3 bits, see alignment (E = 8.3e-05) amino acids 325 to 352 (28 residues), 15.1 bits, see alignment (E = 2.2e-05) PF13181: TPR_8" amino acids 324 to 346 (23 residues), 20.5 bits, see alignment (E = 3e-07) PF14559: TPR_19" amino acids 333 to 374 (42 residues), 34.1 bits, see alignment 2.1e-11 PF13431: TPR_17" amino acids 341 to 372 (32 residues), 26.6 bits, see alignment (E = 3.4e-09)

Best Hits

Predicted SEED Role

"TPR domain protein, putative component of TonB system" in subsystem Ton and Tol transport systems

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165J0Y8 at UniProt or InterPro

Protein Sequence (522 amino acids)

>Ac3H11_3537 TPR domain protein, putative component of TonB system (Acidovorax sp. GW101-3H11)
MTTAAPPATGELQHLLATLMAADDIDAHDLELADSIVQRFPAACEALQARARIHLRLEDA
EAARSDLQAAQALDATHWGNAWVRCLLAHAEGGPALHEALALGQQVLAAHPTHLDTLVTL
GKVHKALDAPEEAAACYRRACQAHPASFRAHNLLMQVLCELGREDEAIALIRAAQVPMHS
YHMAIEYNLGTLLMKKSPRKAIEFLDIARQKMGRINNVQHNRAACLEKLDRYQDAIDEWS
DLLEHEPDWDWPRAGRARCYRDLEQFDAALADLQRLKQADPTSTQHLTLEATIHFDRADY
PAALKALQALEQANELQGEFLTNLLGATYKNMGDLDAARPYFEQAIADDPESYRALNNLA
FCLLHNGRPNKGEATRALAVAEVAMALQPAQWAPREHRARALLALDRTKEALQVFDAWCA
SHPDDGTVALNYATELLNAGDPAQAAQRFEQLMAQGISVPYCHWGLGKALGQLGKKEEAR
ALLLKAQHLYTLDGQTSSAETCAETLADLDKPKSWLRRLMGG