Protein Info for Ac3H11_3386 in Acidovorax sp. GW101-3H11

Annotation: PROBABLE TRANSMEMBRANE PROTEIN

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 298 transmembrane" amino acids 7 to 24 (18 residues), see Phobius details amino acids 35 to 53 (19 residues), see Phobius details amino acids 66 to 84 (19 residues), see Phobius details amino acids 90 to 108 (19 residues), see Phobius details amino acids 119 to 136 (18 residues), see Phobius details amino acids 148 to 169 (22 residues), see Phobius details amino acids 181 to 202 (22 residues), see Phobius details amino acids 212 to 233 (22 residues), see Phobius details amino acids 240 to 266 (27 residues), see Phobius details amino acids 272 to 290 (19 residues), see Phobius details PF00892: EamA" amino acids 9 to 134 (126 residues), 50 bits, see alignment E=1.8e-17

Best Hits

KEGG orthology group: None (inferred from 79% identity to aaa:Acav_0308)

Predicted SEED Role

"PROBABLE TRANSMEMBRANE PROTEIN"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165KGL5 at UniProt or InterPro

Protein Sequence (298 amino acids)

>Ac3H11_3386 PROBABLE TRANSMEMBRANE PROTEIN (Acidovorax sp. GW101-3H11)
MQSPLPFAALLFNAFVWGLAWWPFQHMHQAGLHPLWATAFMYAVVLLALLAWRPTLWTQV
RQHPELWLLALASGLNNVAFNWAVTIGDVVRVILLFYLMPAWAVLLAWKVLGERPTPAAL
LRLALAFSGVLLVLLPEGAPASRLLQNLSLADGLALLGGFMFALTNVTLRRLHAVPGPAR
MFSMFGGCMLMALAVAGIGLQAGVVEPFPAANATWVVTGLLLAGVLMLGNWALQFGAARL
AAGTTALVMLSEVMFASVSSALLGAATLSTRTVLGGALILLASLLAALQFRRPGAAGH