Protein Info for Ac3H11_3372 in Acidovorax sp. GW101-3H11

Annotation: 2,4-dihydroxyhept-2-ene-1,7-dioic acid aldolase (EC 4.1.2.n4)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 277 transmembrane" amino acids 234 to 254 (21 residues), see Phobius details PF03328: HpcH_HpaI" amino acids 18 to 253 (236 residues), 188.2 bits, see alignment E=6.4e-60

Best Hits

KEGG orthology group: K02510, 2,4-dihydroxyhept-2-ene-1,7-dioic acid aldolase [EC: 4.1.2.-] (inferred from 80% identity to vei:Veis_0796)

Predicted SEED Role

"2,4-dihydroxyhept-2-ene-1,7-dioic acid aldolase (EC 4.1.2.n4)" (EC 4.1.2.n4)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.1.2.-, 4.1.2.n4

Use Curated BLAST to search for 4.1.2.- or 4.1.2.n4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165KHW8 at UniProt or InterPro

Protein Sequence (277 amino acids)

>Ac3H11_3372 2,4-dihydroxyhept-2-ene-1,7-dioic acid aldolase (EC 4.1.2.n4) (Acidovorax sp. GW101-3H11)
MHTPTNSFKQALAQGEAQIGLWLGLADAYTAEILAGTGYDWLLVDGEHAPNDLRSILHQL
QAIASASSALPPGARASHAVARVPVGDTALIKQYLDIGAQTLLVPMVDTPEQAQQLVRAT
RYAPEGVRGMGSALARSSRWQAYPRYVHEANQQICLLVQAETVEAMAHLDAIAATPGVDG
VFIGPADLSASMGHPGNPGHPDVQAAIHDGIARILRAGKAPGILATNEAQARQWLAAGAL
FVAVGVDTMLLTSAAQNLLARFRTGPDAAAAPRPAGY