Protein Info for Ac3H11_3335 in Acidovorax sp. GW101-3H11

Annotation: Rod shape-determining protein MreB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 347 TIGR00904: cell shape determining protein, MreB/Mrl family" amino acids 9 to 340 (332 residues), 507.3 bits, see alignment E=9e-157 PF06723: MreB_Mbl" amino acids 11 to 340 (330 residues), 485.2 bits, see alignment E=2e-149 PF00022: Actin" amino acids 15 to 206 (192 residues), 29 bits, see alignment E=1.1e-10 PF00012: HSP70" amino acids 110 to 208 (99 residues), 57.5 bits, see alignment E=2e-19 PF14450: FtsA" amino acids 163 to 321 (159 residues), 41 bits, see alignment E=5.9e-14

Best Hits

Swiss-Prot: 69% identical to MREB_SHIFL: Cell shape-determining protein MreB (mreB) from Shigella flexneri

KEGG orthology group: K03569, rod shape-determining protein MreB and related proteins (inferred from 98% identity to aav:Aave_0294)

Predicted SEED Role

"Rod shape-determining protein MreB" in subsystem Bacterial Cell Division or Bacterial Cytoskeleton

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165KFF1 at UniProt or InterPro

Protein Sequence (347 amino acids)

>Ac3H11_3335 Rod shape-determining protein MreB (Acidovorax sp. GW101-3H11)
MFGAFRRYFSTDLAIDLGTANTLIFARDKGIVLDEPSVVAIRHEGGPHGKKVIQAVGHEA
KAMLGKVPGNIEAIRPMKDGVIADFVITEQMIKQFIKMVHPRTLFTPSPRIIICVPCGST
QVERRAIKDAAEAAGATAVYLIEEPMAAGIGAGLPVSEASGSMVVDIGGGTTEVGVISLG
GMVYKGSVRVGGDKFDEAIISYIRRNYGMLIGEPTAESIKKNIGSAFPGSEVREMEVKGR
NLSEGVPRSFTISSNEVLEALTDPLNQIVSAVKNALEQTPPELGADIADRGMMLTGGGAL
LRDLDRLLAEETGLPVLVAEDPLTCVVRGCGIALERMDRLGSIFTSE