Protein Info for Ac3H11_3296 in Acidovorax sp. GW101-3H11

Annotation: tRNA(Cytosine32)-2-thiocytidine synthetase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 349 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details PF01171: ATP_bind_3" amino acids 87 to 247 (161 residues), 56.2 bits, see alignment E=2e-19

Best Hits

Swiss-Prot: 72% identical to TTCA_POLNA: tRNA-cytidine(32) 2-sulfurtransferase (ttcA) from Polaromonas naphthalenivorans (strain CJ2)

KEGG orthology group: K14058, tRNA 2-thiocytidine biosynthesis protein TtcA (inferred from 72% identity to pna:Pnap_0516)

Predicted SEED Role

"tRNA(Cytosine32)-2-thiocytidine synthetase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165HH24 at UniProt or InterPro

Protein Sequence (349 amino acids)

>Ac3H11_3296 tRNA(Cytosine32)-2-thiocytidine synthetase (Acidovorax sp. GW101-3H11)
MRRRPAVAHCGLPQAAAPLRLSVEISSAPFASPGLFAMSVIATLPDTPPAEAAEKAAAHA
ALKLEKRLVRQVAQAITDFGLIEDGDKVMVCVSGGKDSYGMLDVLRMLQQRNGNKFELIA
VNLDQKQPGFPAHVLPDYLAKVGVPFHIETQDTYSVVKEHIPEGKTMCSLCSRLRRGILY
RVADELGCTKIALGHHRDDMLQTFFLNMFFGGKLKGMPPKVQSDRGDHLIIRPLAYVAED
DLTRWAEIRAFPIIPCTLCGSQENLQRKQIGQMLRDWQQLYPGRIENMAVALRNLVPSHF
MDPRQFDFKGLVPNGVADADGDKAFDAEEFPAQAVGMLAGLPLMPATPR