Protein Info for Ac3H11_3221 in Acidovorax sp. GW101-3H11

Annotation: Cyanate ABC transporter, permease protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 324 transmembrane" amino acids 69 to 90 (22 residues), see Phobius details amino acids 137 to 158 (22 residues), see Phobius details amino acids 168 to 188 (21 residues), see Phobius details amino acids 194 to 215 (22 residues), see Phobius details amino acids 236 to 255 (20 residues), see Phobius details amino acids 259 to 281 (23 residues), see Phobius details amino acids 292 to 315 (24 residues), see Phobius details TIGR01183: nitrate ABC transporter, permease protein" amino acids 114 to 307 (194 residues), 251.5 bits, see alignment E=2.9e-79 PF00528: BPD_transp_1" amino acids 148 to 308 (161 residues), 80.2 bits, see alignment E=8.3e-27

Best Hits

KEGG orthology group: K02050, sulfonate/nitrate/taurine transport system permease protein (inferred from 83% identity to aaa:Acav_3001)

Predicted SEED Role

"Cyanate ABC transporter, permease protein" in subsystem Cyanate hydrolysis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (324 amino acids)

>Ac3H11_3221 Cyanate ABC transporter, permease protein (Acidovorax sp. GW101-3H11)
MVSAVFHSPLDAAPAGAAQNAMNNVATNTLPAGAKAQKTLNPAPVAKPTPAPGAAAPATR
DWTALSRSFWLAVLPPLCGLGLLVGLWAVVSTTTGGSIPSPVETWKQALDIFSNPFYRNG
PNDQGVGWNVLMSLERVAIGFGMAALVGIPAGFVIGRFNFLSRMFNPLISLLRPVSPLAW
LPIGLLVFKGANPAAIWTIFICSIWPMIINTAVGVQRVPQDYMNVARVLNLSEWKIATKI
LFPAVLPYMLTGVRLAVGTAWLVIVAAEMLTGGVGIGFWVWDEWNNLNVKNIIIAIFVIG
IVGLVLEFALIKLATAFTFEEVKA