Protein Info for Ac3H11_3083 in Acidovorax sp. GW101-3H11

Annotation: Benzoyl-CoA oxygenase component A

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 422 TIGR03224: benzoyl-CoA oxygenase/reductase, BoxA protein" amino acids 9 to 422 (414 residues), 743.4 bits, see alignment E=3.2e-228 PF13237: Fer4_10" amino acids 14 to 60 (47 residues), 30.1 bits, see alignment 1.7e-10 PF12837: Fer4_6" amino acids 15 to 35 (21 residues), 24.7 bits, see alignment (E = 7.4e-09) PF00037: Fer4" amino acids 15 to 36 (22 residues), 28.8 bits, see alignment (E = 3.4e-10) PF12800: Fer4_4" amino acids 17 to 33 (17 residues), 16.4 bits, see alignment (E = 4.3e-06) amino acids 47 to 62 (16 residues), 13.3 bits, see alignment (E = 4.1e-05) PF12838: Fer4_7" amino acids 20 to 62 (43 residues), 29.5 bits, see alignment 3.7e-10 PF13187: Fer4_9" amino acids 20 to 63 (44 residues), 29.8 bits, see alignment 2.2e-10 PF00175: NAD_binding_1" amino acids 281 to 389 (109 residues), 45.6 bits, see alignment E=4.4e-15

Best Hits

KEGG orthology group: None (inferred from 84% identity to vpe:Varpa_0111)

Predicted SEED Role

"Benzoyl-CoA oxygenase component A" in subsystem Benzoate transport and degradation cluster

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165JR74 at UniProt or InterPro

Protein Sequence (422 amino acids)

>Ac3H11_3083 Benzoyl-CoA oxygenase component A (Acidovorax sp. GW101-3H11)
MDMAVEAAVIKQHLIDPEICIRCNTCEATCPVGAITHDDNNYVVRADVCNGCMACISPCP
TGSIDNWRTMPLARAYTIEEQLTWEELPPELPPDALAAEGVAPSADAVPPTTPAAPVEPG
TQAFRSAQYGATVPPWSAAHPYTNLFPPKSPTEATVVGNFNCTEAGFENETHHVVLDFGS
MPFPVLEGQSIGIIPPGTDALGKEHHARQYSIASPRNGERPGYNNLALTVKRVTTDHDGN
AVRGIASNFVCDLKVGDKVQVVGPFGSSFLMPNHPRSHIVMICTGTGSAPMRAMTEWRRR
LRSSGKFEGGKLMLFFGARTQQELPYFGPLQNLPKDFIDINLAFSRTAGQPKRYVQDLMR
ERAADLAALLRDGSGHFYVCGLKSMEEGVVMALRDIASEAGLDWDTVGAALQREGRLHLE
TY