Protein Info for Ac3H11_3037 in Acidovorax sp. GW101-3H11

Annotation: Fructose ABC transporter, ATP-binding component FrcA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 268 PF00005: ABC_tran" amino acids 29 to 186 (158 residues), 113.1 bits, see alignment E=1.6e-36

Best Hits

Swiss-Prot: 66% identical to FRCA_RHIML: Fructose import ATP-binding protein FrcA (frcA) from Rhizobium meliloti

KEGG orthology group: K10554, fructose transport system ATP-binding protein (inferred from 87% identity to vpe:Varpa_2270)

Predicted SEED Role

"Fructose ABC transporter, ATP-binding component FrcA" in subsystem Fructose utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165JQ57 at UniProt or InterPro

Protein Sequence (268 amino acids)

>Ac3H11_3037 Fructose ABC transporter, ATP-binding component FrcA (Acidovorax sp. GW101-3H11)
MTTSTQTTNVPLVMQAKGLVKRYGQVTALDGADFELRAGEILAVIGDNGAGKSSLIKALS
GATVPDEGEILLDGQRIQFKSPIEARRAGIETVYQDLAVAPAMTIAENLFLGRELRRPGL
LGTALRMLDKKKMLEESVARMAELKVGIRSMTQAVETLSGGQRQCVAVARAAAFARHVVI
MDEPTAALGVKEGNMVLELIRRVRDKGLPVILISHNMPHVFEIADRIHIARLGKRAAVVN
PKKISMSDTVAVMTGAMAASDLPAECLA