Protein Info for Ac3H11_2976 in Acidovorax sp. GW101-3H11

Annotation: Putative sulfite oxidase subunit YedY

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 334 transmembrane" amino acids 31 to 47 (17 residues), see Phobius details PF00174: Oxidored_molyb" amino acids 113 to 268 (156 residues), 116.7 bits, see alignment E=4.4e-38

Best Hits

Swiss-Prot: 63% identical to MSRP_CHRVO: Protein-methionine-sulfoxide reductase catalytic subunit MsrP (msrP) from Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757)

KEGG orthology group: K07147, (no description) (inferred from 86% identity to aav:Aave_0987)

Predicted SEED Role

"Putative sulfite oxidase subunit YedY"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165L3W6 at UniProt or InterPro

Protein Sequence (334 amino acids)

>Ac3H11_2976 Putative sulfite oxidase subunit YedY (Acidovorax sp. GW101-3H11)
MLIPPRDSGFHHPHPSEITPRAVYEDRRQMLKLMAGGAAGAAMAAWAGREALAQQAQVVR
PNKLAALAGAKSTVAGAVTMEKLTDYKDASTYNNFYEFGTDKADPARNAHTLKTTPWTVE
VEGLVKKPGKYGIEDLIKLSAQEERIYRLRCVEGWSMVIPWVGYSLAELIKRVEPQGSAK
YVEFVTLADKATMPYVGSRVLDWPYVEGLRLDEAMNPLTLLAFGMYGEVLPNQNGAPVRL
VVPWKYGFKSAKSIVKIRFVEKEPGTAWNKAAKQEYGFYSNVNPEVDHPRWSQATERRIG
EDGLFAKKRKTLMFNGYEAQVGQLYAGMDLKKFY