Protein Info for Ac3H11_2845 in Acidovorax sp. GW101-3H11

Annotation: Integral membrane protein, interacts with FtsH

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 241 transmembrane" amino acids 39 to 59 (21 residues), see Phobius details amino acids 66 to 85 (20 residues), see Phobius details amino acids 97 to 119 (23 residues), see Phobius details amino acids 125 to 146 (22 residues), see Phobius details amino acids 157 to 175 (19 residues), see Phobius details amino acids 181 to 198 (18 residues), see Phobius details amino acids 211 to 236 (26 residues), see Phobius details PF01027: Bax1-I" amino acids 33 to 233 (201 residues), 151.7 bits, see alignment E=1.2e-48

Best Hits

Swiss-Prot: 33% identical to Y402_PASMU: Uncharacterized protein PM0402 (PM0402) from Pasteurella multocida (strain Pm70)

KEGG orthology group: K06890, (no description) (inferred from 91% identity to ajs:Ajs_2411)

Predicted SEED Role

"Integral membrane protein, interacts with FtsH"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A162F7L6 at UniProt or InterPro

Protein Sequence (241 amino acids)

>Ac3H11_2845 Integral membrane protein, interacts with FtsH (Acidovorax sp. GW101-3H11)
VQANKERHKMMNDQVTTLGHSAGYGISQEERHKVLRNTYWLLALSMIPTVLGAWIGVATG
ITRSLTGGLGLIVFLGGAFAFMFAIEKTKRSAAGVPVLLAFTFFMGLMLSRLIGMVLGFK
NGTDLIMTAFAGTAGVFFVMASLASVIKRDLSGMGKWLMVGALVLMVGGIINVFVGSTVG
MMVISMLAIGIFSAYMLYDLKQILDGGETNYISATLALYLDIFNVFQSLLALLGIMGGER
E