Protein Info for Ac3H11_2756 in Acidovorax sp. GW101-3H11

Annotation: Permease of the drug/metabolite transporter (DMT) superfamily

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 297 transmembrane" amino acids 12 to 28 (17 residues), see Phobius details amino acids 40 to 59 (20 residues), see Phobius details amino acids 72 to 92 (21 residues), see Phobius details amino acids 98 to 119 (22 residues), see Phobius details amino acids 127 to 144 (18 residues), see Phobius details amino acids 150 to 168 (19 residues), see Phobius details amino acids 180 to 201 (22 residues), see Phobius details amino acids 216 to 238 (23 residues), see Phobius details amino acids 245 to 266 (22 residues), see Phobius details amino acids 272 to 292 (21 residues), see Phobius details PF00892: EamA" amino acids 11 to 142 (132 residues), 77.3 bits, see alignment E=6.3e-26 amino acids 157 to 287 (131 residues), 51.2 bits, see alignment E=7.3e-18

Best Hits

Predicted SEED Role

"Permease of the drug/metabolite transporter (DMT) superfamily" in subsystem Queuosine-Archaeosine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A162F6X0 at UniProt or InterPro

Protein Sequence (297 amino acids)

>Ac3H11_2756 Permease of the drug/metabolite transporter (DMT) superfamily (Acidovorax sp. GW101-3H11)
MTGFVLSRRQVWLLVFVTLFWGVNWPIMKSAVGAYPAMAFRAWSMVLGLPCLWVGLKLLR
VPLQVPRRYWGELLLLATTNMVAWHLCLMWALPGLSSGRAAIIGYTMPVFSALWGMLLYR
QRLSRPQWVGVGSATAGVVLLLWHEFSRLSGVPLAGLTLLAGTAVWALGTQQLRRSAMDV
PVLAIGFWMTAITTVAVLLYVGSTDGLPANQPSPRVWAAIAYNALLIFGFCHVAWFALAR
ALPPVAASVSISLIPVLGLLSGALWLNEALHWQDGAAVLLIMLAIGVALHPAGTETS