Protein Info for Ac3H11_2600 in Acidovorax sp. GW101-3H11

Annotation: Probable transmembrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 475 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details transmembrane" amino acids 37 to 60 (24 residues), see Phobius details amino acids 69 to 90 (22 residues), see Phobius details amino acids 101 to 120 (20 residues), see Phobius details amino acids 132 to 155 (24 residues), see Phobius details amino acids 167 to 186 (20 residues), see Phobius details amino acids 194 to 211 (18 residues), see Phobius details amino acids 216 to 234 (19 residues), see Phobius details amino acids 258 to 277 (20 residues), see Phobius details amino acids 290 to 311 (22 residues), see Phobius details amino acids 332 to 351 (20 residues), see Phobius details amino acids 373 to 395 (23 residues), see Phobius details amino acids 404 to 428 (25 residues), see Phobius details amino acids 452 to 474 (23 residues), see Phobius details PF16980: CitMHS_2" amino acids 33 to 474 (442 residues), 668 bits, see alignment E=3.1e-205

Best Hits

KEGG orthology group: None (inferred from 83% identity to vei:Veis_2068)

Predicted SEED Role

"Probable transmembrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165KXD0 at UniProt or InterPro

Protein Sequence (475 amino acids)

>Ac3H11_2600 Probable transmembrane protein (Acidovorax sp. GW101-3H11)
METQPMKLTRGLAVASLLAALPGWALAADIDGSTLSVLWGVPFAGILLSIALMPLLAPIF
WHHHFGKVAAAWGLAFLVPFAITFGPGMAGVSLVHALLAEYIPFVILLTALFTVAGGIFI
RGNLHGSPGLNTAILAIGAVLASFMGTTGASMLLIRPLIRANDNRKHVAHVVVFFIFIVS
NAGGSLTPLGDPPLFLGFLKGVDFFWTVSHIFQETLFLVGALLVIFFVLDSWYYHRREEL
LRTDPTPDSRSIGFDGKVNFALLGAVVALVLLSGFWKSSVVFNIAGTEVGLPGIVRDVGL
IIVTLVSLWLTPKKVHEDNQFGWGPMQEVAKLFAGIFLTIIPVIAMLKAGVNGPFGAIVA
AVTRPDGSPDPAMYFWAAGALSSFLDNAPTYLVFFNTAGGDPAVLMTTLAPTLAAISAGA
VFMGANTYIGNAPNLMVKAIAEDRGVKMPSFFGYMLWSGGILVPLFVVMTFIWFR