Protein Info for Ac3H11_2561 in Acidovorax sp. GW101-3H11

Updated annotation (from data): ABC transporter for L-Histidine, permease component 2
Rationale: Specific phenotypes on L-Histidine. In a gene cluster that also includes hutD and imidazolonepropionase. Some subunits are annotated as transporting glutamine.
Original annotation: ABC transporter, permease protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 252 signal peptide" amino acids 7 to 11 (5 residues), see Phobius details amino acids 25 to 37 (13 residues), see Phobius details transmembrane" amino acids 12 to 24 (13 residues), see Phobius details amino acids 62 to 86 (25 residues), see Phobius details amino acids 98 to 118 (21 residues), see Phobius details amino acids 124 to 144 (21 residues), see Phobius details amino acids 185 to 208 (24 residues), see Phobius details amino acids 220 to 238 (19 residues), see Phobius details PF00528: BPD_transp_1" amino acids 76 to 245 (170 residues), 92.6 bits, see alignment E=1.3e-30

Best Hits

KEGG orthology group: K02050, sulfonate/nitrate/taurine transport system permease protein (inferred from 88% identity to vei:Veis_3642)

Predicted SEED Role

"ABC transporter, permease protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165KWL8 at UniProt or InterPro

Protein Sequence (252 amino acids)

>Ac3H11_2561 ABC transporter for L-Histidine, permease component 2 (Acidovorax sp. GW101-3H11)
VSARARWMLGLAFFVVFVAVWAFFTLGGFVSPTFLASPITMAKEGWLLFTEYGFIKDIGM
TIWRVVGGFVLAAVIAVPLGIAMGAYKGIEAFFEPFISFCRYLPASAFIPLLILWAGIGE
AQKILVIFIGSVFQITLMVAVTVGGARRDLVEAAYTLGAGHKGIVTRVLIPGAAPEIAET
LRLVLGWAWTYVIVAELIGSSSGIGHMITDSQSLLNTGQIIFGIIIIGLIGLVSDFAFKA
LNHRLFAWSFVR