Protein Info for Ac3H11_2559 in Acidovorax sp. GW101-3H11

Annotation: Histidine utilization repressor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 270 signal peptide" amino acids 1 to 33 (33 residues), see Phobius details TIGR02018: histidine utilization repressor" amino acids 35 to 261 (227 residues), 298.9 bits, see alignment E=1.1e-93 PF00392: GntR" amino acids 35 to 98 (64 residues), 75.9 bits, see alignment E=2.3e-25 PF08220: HTH_DeoR" amino acids 62 to 93 (32 residues), 23.5 bits, see alignment 5.5e-09 PF07702: UTRA" amino acids 119 to 256 (138 residues), 123.2 bits, see alignment E=1.1e-39

Best Hits

Swiss-Prot: 50% identical to HUTC_KLEAE: Histidine utilization repressor (hutC) from Klebsiella aerogenes

KEGG orthology group: K05836, GntR family transcriptional regulator, histidine utilization repressor (inferred from 86% identity to vei:Veis_3644)

Predicted SEED Role

"Histidine utilization repressor" in subsystem Histidine Degradation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165KWK5 at UniProt or InterPro

Protein Sequence (270 amino acids)

>Ac3H11_2559 Histidine utilization repressor (Acidovorax sp. GW101-3H11)
MSARPSRRTAATAPRSATPTKAVAAVAAPAQAMALYEQVKDHISRKIQEGIWRAGDRLPS
ENELVTQFGISRMTVNRALRELVEQGRIVRVAGVGSFVAEDKPQSTLLQIANLASEIRQR
GHDYRCDVLTVERTSATLEVAAALDLRTGESVFHSLCIHREDGLPVQLEDRHVNPRQVPQ
FAAQDFTQLQPSEYLVRNVPFDQIEHVVDAVMPTAEQAALLEMSPQEPCLLLTRRTWSRG
VPITVVRCLHPATRYRLGSRFRADGNPVAG