Protein Info for Ac3H11_2351 in Acidovorax sp. GW101-3H11

Annotation: Membrane fusion component of tripartite multidrug resistance system

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 440 transmembrane" amino acids 21 to 41 (21 residues), see Phobius details PF00529: CusB_dom_1" amino acids 43 to 358 (316 residues), 26.2 bits, see alignment E=1.2e-09 PF13533: Biotin_lipoyl_2" amino acids 58 to 106 (49 residues), 36.4 bits, see alignment 7.3e-13 PF16576: HlyD_D23" amino acids 212 to 300 (89 residues), 47.8 bits, see alignment E=2.3e-16 PF13437: HlyD_3" amino acids 229 to 349 (121 residues), 58 bits, see alignment E=2.9e-19

Best Hits

Swiss-Prot: 41% identical to EMRA_HAEIN: Multidrug export protein EmrA (emrA) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: K03543, multidrug resistance protein A (inferred from 69% identity to dac:Daci_3743)

Predicted SEED Role

"Membrane fusion component of tripartite multidrug resistance system" in subsystem Multidrug Resistance, Tripartite Systems Found in Gram Negative Bacteria

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165KSS2 at UniProt or InterPro

Protein Sequence (440 amino acids)

>Ac3H11_2351 Membrane fusion component of tripartite multidrug resistance system (Acidovorax sp. GW101-3H11)
MTANSEPLTANEANTARRRGLTIIAAAVAIAAIGWGGWHWANGRHVETTDNAYVAGNVVQ
ITPQIGGTVVSIGADDTDYVKAGQLLVKLDPADARVALEQAEAQLAQTVREVRTLYANNA
TLKAQVSLRSADLARAQADSARMQDDVNRRAPLMASGAVGKEEFQHASAQLAAAKSTVAA
AQSAVLAAQEQLAASQTQTEGTSIEQHPNVARASARVREAYLAVQRAQLVAPLDGHVAKR
GVQVGQRVQAGAPLMTLVPLNDLWVDANFKESQLKTLRIGQTAELEADVYGTKVVYHGTV
TGLGAGTGAAFALLPAQNATGNWIKVVQRVPVRIALDPKEVAEHPLRVGLSMEVKVDTAD
QTGKTLADTQRTTPVAATAVFDAQFKAADDEVAHIIAANLGRSGKAAVAVASPKVGKAPV
ASQQHASAPTAATVQSPVVQ