Protein Info for Ac3H11_2320 in Acidovorax sp. GW101-3H11

Annotation: Transcriptional regulator, XRE family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 497 PF13560: HTH_31" amino acids 17 to 72 (56 residues), 42.8 bits, see alignment 1.3e-14 PF13443: HTH_26" amino acids 20 to 72 (53 residues), 24 bits, see alignment 9.6e-09 PF01381: HTH_3" amino acids 21 to 73 (53 residues), 48 bits, see alignment 2.5e-16 PF06114: Peptidase_M78" amino acids 207 to 328 (122 residues), 66.8 bits, see alignment E=4.1e-22 PF09856: ScfRs" amino acids 329 to 485 (157 residues), 239 bits, see alignment E=5.1e-75

Best Hits

KEGG orthology group: K07110, (no description) (inferred from 76% identity to adn:Alide_1906)

Predicted SEED Role

"Transcriptional regulator, XRE family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165L585 at UniProt or InterPro

Protein Sequence (497 amino acids)

>Ac3H11_2320 Transcriptional regulator, XRE family (Acidovorax sp. GW101-3H11)
MNGATPLPKETMKKTFMGVRLRRLREERGMTQIALARALDLSASYLNQLEQNQRPLTVPV
LLKINAVFGVDVQRFSDDDEARLITGLREVLADLPAGLGGEGAGEAVSLAEIRELAAGMP
AVARTLLALHQRHRQALERLAALGNDRGGEGAMAHHPPMAYEEVRDFFFARQNHIAELDD
AAEQCAADWGLLPGRADEALAQRLLAAHGVRVVDVADLPGQAQRVFQADTGLLQLAAGLE
RGQRAFQMATQLAFLEQGAELQRLADSAGLSSDQARALARIGLANYFAGALVLPYTAFLR
AAEAAHYDIDRLGHQFGVGFETVCHRLSTLQRPSARGVPFFFIRVDRAGNISKRQSATHF
HFSKIGGTCPLWNVYEAFAQPGRTVPQVARMPDGRAYLWVARTVARGGGGWGVPGKEFSV
ALGCDIRHAPQLVYSRGLDLANPEAAVPIGMGCKVCERDACPQRAFPPIGRALDVNENHS
RFAPYPVAAPQTATHRS