Protein Info for Ac3H11_2286 in Acidovorax sp. GW101-3H11

Annotation: acyltransferase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 195 transmembrane" amino acids 55 to 70 (16 residues), see Phobius details amino acids 136 to 152 (17 residues), see Phobius details PF01553: Acyltransferase" amino acids 30 to 148 (119 residues), 52.9 bits, see alignment E=1.7e-18

Best Hits

KEGG orthology group: None (inferred from 57% identity to dal:Dalk_1391)

Predicted SEED Role

"acyltransferase family protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A162DK49 at UniProt or InterPro

Protein Sequence (195 amino acids)

>Ac3H11_2286 acyltransferase family protein (Acidovorax sp. GW101-3H11)
MHHTIFDTPVVNTLLRAFSRLTLRITGWKVEGALPAHAAKSVLIAAPHTSNWDLPYTLML
AFSLRLRVYWMGKHSLFKAPFGGVMRWLGGIPVDRSQANNLVASSAQAMRDAEGPMQLIV
PPEGTRGKTRHWKTGFYFIAQQAGVPIVLAFVDYGRKVGGLGPVFEPTGDVERDMAAIKA
FYAPIRGKNPTQFEA