Protein Info for Ac3H11_2277 in Acidovorax sp. GW101-3H11

Annotation: putative periplasmic protein kinase ArgK and related GTPases of G3E family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 471 PF01541: GIY-YIG" amino acids 4 to 73 (70 residues), 53.6 bits, see alignment E=3.3e-18 TIGR00750: LAO/AO transport system ATPase" amino acids 147 to 445 (299 residues), 334 bits, see alignment E=3.7e-104 PF03308: MeaB" amino acids 152 to 423 (272 residues), 365.9 bits, see alignment E=1.6e-113

Best Hits

Predicted SEED Role

"putative periplasmic protein kinase ArgK and related GTPases of G3E family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (471 amino acids)

>Ac3H11_2277 putative periplasmic protein kinase ArgK and related GTPases of G3E family (Acidovorax sp. GW101-3H11)
MRPFYVYILRCADGSYYVGHTDDMVLRMQQHENGKVGYTALRKPLELMWQGEFETREGAL
AFELQIKGWSRVKKEALMAGDWERVQELAQSRGKVASAPRLRQAQPERVGGDEVSPPPTV
HSEPVEGRAKPAHALMEGVIGQPGPVQRRAMSKAITLLESTRTDHRAQADELLTQLLPHT
GKAFRLGISGVPGVGKSTFIEALGLYLIGQGHRVAVLTIDPSSTVSGGSILGDKTRMEHL
SVHEKAYIRPSPSSGTLGGVAEKTREAMLVCEAAGYDVVIVETVGVGQSEIAVAGMTDMF
VLMQLPNAGDDLQAIKKGVMEIADLVVINKADIDKNAATRAEAQITSSLRLLSQHGNPEN
AHHNETLWHPKVVQISALLGQGVDSFWAAVTQFRQLQTANGRLATRREKQALAWMWERID
AGLKLAFRQHPQVKELLPQMQADVAAGRIAASTAARNLLLAHTQQAQAAIK