Protein Info for Ac3H11_2207 in Acidovorax sp. GW101-3H11

Annotation: Chromate resistance protein ChrB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 322 PF20229: ChrB_N" amino acids 17 to 91 (75 residues), 26.5 bits, see alignment E=5.4e-10 PF09828: ChrB_C" amino acids 178 to 305 (128 residues), 150.2 bits, see alignment E=4.4e-48

Best Hits

Swiss-Prot: 45% identical to CHRB1_CUPMC: Protein ChrB (chrB1) from Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)

KEGG orthology group: None (inferred from 49% identity to rme:Rmet_3866)

Predicted SEED Role

"Chromate resistance protein ChrB"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A168F6P3 at UniProt or InterPro

Protein Sequence (322 amino acids)

>Ac3H11_2207 Chromate resistance protein ChrB (Acidovorax sp. GW101-3H11)
MWSTLIMTLPTQPNAVRLRVWRNLKALGCAALRDGAYLLPEEHAGLLAPIAAEVREHGGT
AMVLTLTANDATQRQEIEALFDRTEAFTQWRDTATTLQAELPQLTETDARRRLRSIADAL
QALHRTDYYPGAAAAQADADLASLRQALDACFSRGEPAALPAHGIPRLDAARFQNQRWAT
RARPWVDRLACAWLIRRFIDPGAQWVWLADPASAPADVLGFDFDGARFTHVGALVTFEVL
IASFGLEADPRLQRLARAVHYLDAGGMPVPEAAGLEAVLAGLREVHADDNTLTQAAAQVF
DALYAVPPPSSTSPSTVPSAAP