Protein Info for Ac3H11_2113 in Acidovorax sp. GW101-3H11

Annotation: Permease of the drug/metabolite transporter (DMT) superfamily

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 277 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details transmembrane" amino acids 30 to 49 (20 residues), see Phobius details amino acids 61 to 81 (21 residues), see Phobius details amino acids 92 to 111 (20 residues), see Phobius details amino acids 117 to 135 (19 residues), see Phobius details amino acids 141 to 161 (21 residues), see Phobius details amino acids 172 to 191 (20 residues), see Phobius details amino acids 203 to 220 (18 residues), see Phobius details amino acids 232 to 250 (19 residues), see Phobius details amino acids 256 to 274 (19 residues), see Phobius details PF00892: EamA" amino acids 3 to 130 (128 residues), 49 bits, see alignment E=3.6e-17 amino acids 143 to 272 (130 residues), 46.3 bits, see alignment E=2.4e-16

Best Hits

KEGG orthology group: None (inferred from 85% identity to vei:Veis_1560)

Predicted SEED Role

"Permease of the drug/metabolite transporter (DMT) superfamily" in subsystem Queuosine-Archaeosine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A168F3X7 at UniProt or InterPro

Protein Sequence (277 amino acids)

>Ac3H11_2113 Permease of the drug/metabolite transporter (DMT) superfamily (Acidovorax sp. GW101-3H11)
MQANLYALGAIALWASLASLGVSLTHVPPFLLTGIALIIGSVPAWPFVLRDPSQWRIPLR
TLALGVYGLFAYHFLLFIALRHAPPVEANLVNYLWPLFIVVLSPVVLPGVALRLPHLLAA
LLGFGGAAIAIAGGRELSGTLAWGYLPALAAAFIWATYSLLTKRVAAFPTTAIGLFGLVS
GVLSLLCHVALEPAVSLQPRDWALLAVLGLGPLGASFFMWDKALKLGDARHIGILSYITP
LASTALLIVASGRQFSASIALATVMIIGAAVMGMRAR