Protein Info for Ac3H11_2066 in Acidovorax sp. GW101-3H11

Updated annotation (from data): glucose ABC transporter, ATPase component
Rationale: Specifically important for utilizing glucose. Also mildly important for mannose utilization and likely transports it as well.
Original annotation: SN-glycerol-3-phosphate transport ATP-binding protein UgpC (TC 3.A.1.1.3)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 355 PF00005: ABC_tran" amino acids 24 to 166 (143 residues), 122.8 bits, see alignment E=4.2e-39 PF17912: OB_MalK" amino acids 240 to 284 (45 residues), 33.5 bits, see alignment 1.6e-11 PF08402: TOBE_2" amino acids 277 to 345 (69 residues), 47 bits, see alignment E=5.7e-16

Best Hits

Swiss-Prot: 55% identical to UGPC_RUEST: sn-glycerol-3-phosphate import ATP-binding protein UgpC (ugpC) from Ruegeria sp. (strain TM1040)

KEGG orthology group: K02023, multiple sugar transport system ATP-binding protein (inferred from 71% identity to pna:Pnap_3693)

Predicted SEED Role

"SN-glycerol-3-phosphate transport ATP-binding protein UgpC (TC 3.A.1.1.3)" (TC 3.A.1.1.3)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165KQ08 at UniProt or InterPro

Protein Sequence (355 amino acids)

>Ac3H11_2066 glucose ABC transporter, ATPase component (Acidovorax sp. GW101-3H11)
MASSLDIAGINKRFGKGDKSVEVLRKVDIHVAPGEFLILVGPSGCGKSTLLNIIAGLDEP
TEGEIRIGGKNVVGMPPRDRDIAMVFQSYALYPTLSVADNIGFALEMRKMPKPERQKRID
EVAAMLQISHLLDRRPSQLSGGQRQRVAMGRALARQPQLFLFDEPLSNLDAKLRVEMRAE
IKRLHQASGITSVYVTHDQVEAMTLGSRIAVMKGGVVQQLGTPDEIYNRPANTYVATFIG
SPTMNLLRGAVTGGQFGIQGAALNLAPPPSSANEVLLGVRPEHLVMQETAPWRGRVSVVE
PTGPDTYVMVDTAAGSVTLRTDAQTRVQPGEHVGLALAPAHAHWFDAQSEERLVA