Protein Info for Ac3H11_2051 in Acidovorax sp. GW101-3H11

Annotation: Oligopeptide transport system permease protein OppB (TC 3.A.1.5.1)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 348 PF00005: ABC_tran" amino acids 34 to 193 (160 residues), 113.1 bits, see alignment E=2.5e-36 PF13304: AAA_21" amino acids 161 to 228 (68 residues), 28.5 bits, see alignment E=2.3e-10 TIGR01727: oligopeptide/dipeptide ABC transporter, ATP-binding protein, C-terminal domain" amino acids 243 to 327 (85 residues), 79.3 bits, see alignment E=9e-27 PF08352: oligo_HPY" amino acids 245 to 308 (64 residues), 69.3 bits, see alignment E=4.5e-23

Best Hits

Swiss-Prot: 48% identical to DPPD_ECOLI: Dipeptide transport ATP-binding protein DppD (dppD) from Escherichia coli (strain K12)

KEGG orthology group: K02031, peptide/nickel transport system ATP-binding protein (inferred from 86% identity to aaa:Acav_0890)

MetaCyc: 48% identical to dipeptide ABC transporter ATP binding subunit DppD (Escherichia coli K-12 substr. MG1655)
ABC-8-RXN [EC: 7.4.2.9]

Predicted SEED Role

"Oligopeptide transport system permease protein OppB (TC 3.A.1.5.1)" in subsystem ABC transporter oligopeptide (TC 3.A.1.5.1) (TC 3.A.1.5.1)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.4.2.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165L4I0 at UniProt or InterPro

Protein Sequence (348 amino acids)

>Ac3H11_2051 Oligopeptide transport system permease protein OppB (TC 3.A.1.5.1) (Acidovorax sp. GW101-3H11)
LNKNNKKSDIPMSLLEVKNLVVEFPGRRGTLRALDDISFSIAPGEILGVVGESGAGKSLT
GAAIIGLLEPPGRVASGQILLEGQRIDNLSNEEMRHIRGRRIGAIFQDPLTSLNPLYTVG
RQLTETILAHLPVTPAEARQRAIALLKDTGIPAAEERIDHYPHQFSGGMRQRVVIALALA
AEPKLIVADEPTTALDVSIQAQIITLLKNICKSRGAAVMLITHDMGVIAETCDRVAVLYA
GRVAEIGPVHDVINKPSHPYTSGLMASIPDMTMDRERLNQIDGAMPRLNAIPKGCAYNPR
CPQTFDRCMTERPDLMPAGSTRAACWLHAGASTTAPTATAATKAGVTA