Protein Info for Ac3H11_1976 in Acidovorax sp. GW101-3H11

Annotation: RNA 3'-terminal phosphate cyclase (EC 6.5.1.4)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 379 transmembrane" amino acids 117 to 135 (19 residues), see Phobius details TIGR03399: RNA 3'-phosphate cyclase" amino acids 31 to 362 (332 residues), 338.7 bits, see alignment E=1.8e-105 PF01137: RTC" amino acids 37 to 364 (328 residues), 251.1 bits, see alignment E=7.4e-79 PF05189: RTC_insert" amino acids 212 to 305 (94 residues), 39.7 bits, see alignment E=5.5e-14

Best Hits

Swiss-Prot: 46% identical to RTCA_KORVE: RNA 3'-terminal phosphate cyclase (rtcA) from Koribacter versatilis (strain Ellin345)

KEGG orthology group: K01974, RNA 3'-terminal phosphate cyclase [EC: 6.5.1.4] (inferred from 64% identity to vap:Vapar_4419)

Predicted SEED Role

"RNA 3'-terminal phosphate cyclase (EC 6.5.1.4)" in subsystem RNA 3'-terminal phosphate cyclase (EC 6.5.1.4)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.5.1.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A162F7D1 at UniProt or InterPro

Protein Sequence (379 amino acids)

>Ac3H11_1976 RNA 3'-terminal phosphate cyclase (EC 6.5.1.4) (Acidovorax sp. GW101-3H11)
MHEKQQKMLHSAHTVAPNMRVEVVQEQQPLTLDGSTGEGGGQILRTGLALSMVTGRPLHI
TRIRAGRPKPGLMRQHLACVQAAVAVCGGQAEGAELGSQTLVFTPSAVRAGDYRFQIATA
GSCLLVLQTVLPALMLADDPSKVELSGGTHNPMAPPFDFLERAFAPLVRRLGVGVDLQLQ
RRGFYPAGGGELVAHITPASATTQPLAPVDLLERGPLHNAWGEALVPGLARNIATRELEA
LGQRMGWTFESGQLRQPPTRQNEGPGNALIATLEHAHVTEVFCQLGERSLSAEQVAKRLV
DEVRAYQRSTGALGPHLADQWMLPLALAVWRSGRAARYTCTEVTQHTATNAQTIALGLPV
RVQITPVERAMQVEILPAP