Protein Info for Ac3H11_1926 in Acidovorax sp. GW101-3H11

Annotation: Isohexenylglutaconyl-CoA hydratase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00378: ECH_1
  • amino acids 29 to 279 (251 residues), 131.2 bits, E=4.5e-42
• PF16113: ECH_2
  • amino acids 32 to 240 (209 residues), 99.8 bits, E=2.3e-32

Best Hits

KEGG orthology group: K13779, isohexenylglutaconyl-CoA hydratase [EC: 4.2.1.57] (inferred from 49% identity to bpd:BURPS668_A2931)

Predicted SEED Role

"Isohexenylglutaconyl-CoA hydratase"

MetaCyc Pathways

• cis-geranyl-CoA degradation (4/9 steps found)

KEGG Metabolic Maps

• Geraniol degradation

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.2.1.57

Sequence Analysis Tools

See A0A165KLF5 at UniProt or InterPro

Protein Sequence (282 amino acids)

>Ac3H11_1926 Isohexenylglutaconyl-CoA hydratase (Acidovorax sp. GW101-3H11)
MQPAARAQWITEMTPASLLIDRVPLPSGSVETWTLNDPASRNALSEAMVDALLAACERAA
ADADLRGVVLRGAGGHFCAGGSLGGFAKTIGQPLASGEDDPLVPLNRRFGALLQALCALP
QWLIVAVEGAAMGGGFGLVCCADQVLAHASAQFATPEVTLGIVPAQIAPFVVQRLGPAAA
RRCLLTGERWDAATAQRLGLVDDVVEGDMDAAVRAAIARHTAAAPQAVAATKRLLLAQPD
KPLPALLDDAAIAFAQALRGPEAPQGLAAFAARKVPPWSANS