Protein Info for Ac3H11_1908 in Acidovorax sp. GW101-3H11

Annotation: Response regulator receiver:Transcriptional regulatory protein, C- terminal

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 230 PF00072: Response_reg" amino acids 4 to 115 (112 residues), 94.7 bits, see alignment E=4.1e-31 PF00486: Trans_reg_C" amino acids 153 to 225 (73 residues), 64.3 bits, see alignment E=9.2e-22

Best Hits

Swiss-Prot: 45% identical to QSEB_ECOLI: Transcriptional regulatory protein QseB (qseB) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 89% identity to aaa:Acav_4008)

Predicted SEED Role

"Response regulator receiver:Transcriptional regulatory protein, C- terminal"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165KL51 at UniProt or InterPro

Protein Sequence (230 amino acids)

>Ac3H11_1908 Response regulator receiver:Transcriptional regulatory protein, C- terminal (Acidovorax sp. GW101-3H11)
MRLLLVEDDVMVASGIKLGLTDAGYAVDWVGSGERAEEVLRTESFDAAIIDIGLPAMDGL
ELTRRLRRPDMASPAMPVLILTARDALHDRVQGLDLGADDYMVKPFELPELLARLRALLR
RSQAATTAVLSFGPLELDTAGRRASIRSDAGEQVIELGPREWTVLEYLLINAPKPASKDK
LLQALTGWDKEITPNAVEVYVSRLRGKLEPHGVALRSIRGFGYRLELQNP