Protein Info for Ac3H11_1852 in Acidovorax sp. GW101-3H11

Annotation: Transcriptional regulator, AsnC family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 160 PF13412: HTH_24" amino acids 7 to 53 (47 residues), 60.9 bits, see alignment E=1.4e-20 PF13404: HTH_AsnC-type" amino acids 7 to 48 (42 residues), 64.5 bits, see alignment E=1.2e-21 PF01047: MarR" amino acids 14 to 56 (43 residues), 25.2 bits, see alignment E=2.6e-09 PF01037: AsnC_trans_reg" amino acids 81 to 150 (70 residues), 81 bits, see alignment E=9.4e-27

Best Hits

Swiss-Prot: 37% identical to DECR_ECOL6: DNA-binding transcriptional activator DecR (decR) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: None (inferred from 92% identity to aaa:Acav_4058)

Predicted SEED Role

"Transcriptional regulator, AsnC family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165KJQ2 at UniProt or InterPro

Protein Sequence (160 amino acids)

>Ac3H11_1852 Transcriptional regulator, AsnC family (Acidovorax sp. GW101-3H11)
MKAFDALDKLDRAILRRLQENGRETYDVIGEQVGLSPSAVLRRVKRLEDSGVIDRYVALV
PPEAVGLGLTAYLNVRLEKHTESHKRNPMDLFRASVQTWPEVVECASLTGEMDYLLRVVV
ADMAHYSRFIMDTLLKHPSVQDCKTSFVLDRVKATTAVPV