Protein Info for Ac3H11_1771 in Acidovorax sp. GW101-3H11

Annotation: tRNA nucleotidyltransferase, A-adding (EC 2.7.7.25)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 237 PF00571: CBS" amino acids 94 to 144 (51 residues), 33.6 bits, see alignment E=2e-12 amino acids 167 to 222 (56 residues), 48.6 bits, see alignment E=4.1e-17

Best Hits

KEGG orthology group: None (inferred from 79% identity to aav:Aave_3769)

Predicted SEED Role

"tRNA nucleotidyltransferase, A-adding (EC 2.7.7.25)" in subsystem Polyadenylation bacterial or tRNA nucleotidyltransferase (EC 2.7.7.25)

Isozymes

Compare fitness of predicted isozymes for: 2.7.7.25

Use Curated BLAST to search for 2.7.7.25

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165KDY9 at UniProt or InterPro

Protein Sequence (237 amino acids)

>Ac3H11_1771 tRNA nucleotidyltransferase, A-adding (EC 2.7.7.25) (Acidovorax sp. GW101-3H11)
MFFVFGPSGQMYRGGPENLAQISSVRRVQRPQALRTRALDLPGEPVPVFPAPPHAATAEA
TTPAVVNLRLQDAVSAYAQTEQGPQHARQPLTRVSDVMTRGALSVQPDARVNNAWQTLAE
HKVAQAPVVDVLGRVIGLLVRADMAPLDLLPEPGAVKQAIDLARRPVAEVMVSPVPTVSP
DTELRRVAAVLLDTGLPGLPVTDEAGVLSGFISRTDILRAVAADPPLDLWSGPAVPL