Protein Info for Ac3H11_1736 in Acidovorax sp. GW101-3H11

Annotation: G:T/U mismatch-specific uracil/thymine DNA-glycosylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 189 TIGR04274: DNA-deoxyinosine glycosylase" amino acids 20 to 179 (160 residues), 145.7 bits, see alignment E=5.6e-47 PF03167: UDG" amino acids 30 to 180 (151 residues), 31 bits, see alignment E=1.2e-11

Best Hits

KEGG orthology group: None (inferred from 72% identity to vei:Veis_4022)

Predicted SEED Role

"G:T/U mismatch-specific uracil/thymine DNA-glycosylase" in subsystem DNA repair, bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165KEW4 at UniProt or InterPro

Protein Sequence (189 amino acids)

>Ac3H11_1736 G:T/U mismatch-specific uracil/thymine DNA-glycosylase (Acidovorax sp. GW101-3H11)
MFDPGATGLMSAPAAVRWQGLPPVASEVTVVLVLGSFPGAASLRAQQYYAHPQNHFWKIL
QALWPQHPLPVAGPEHYAQRCDWLLARGLGLWDVYASCEREGSLDTSIRNPQVNDFARLL
GRCPRLVAVAHNGAESFRHAPAVLASLGSQHRLQLQAVRLPSTSPANASWSFDRKLAAWA
AVLSAHHLL