Protein Info for Ac3H11_1725 in Acidovorax sp. GW101-3H11

Annotation: diguanylate cyclase/phosphodiesterase (GGDEF & EAL domains) with PAS/PAC sensor(s)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 850 894 transmembrane" amino acids 12 to 34 (23 residues), see Phobius details amino acids 149 to 160 (12 residues), see Phobius details amino acids 287 to 310 (24 residues), see Phobius details PF12860: PAS_7" amino acids 331 to 446 (116 residues), 78.5 bits, see alignment E=9.1e-26 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 449 to 617 (169 residues), 139.6 bits, see alignment E=4e-45 PF00990: GGDEF" amino acids 453 to 614 (162 residues), 157.7 bits, see alignment E=4.5e-50 PF00563: EAL" amino acids 635 to 870 (236 residues), 230.7 bits, see alignment E=3.4e-72

Best Hits

KEGG orthology group: None (inferred from 60% identity to aaa:Acav_3370)

Predicted SEED Role

"diguanylate cyclase/phosphodiesterase (GGDEF & EAL domains) with PAS/PAC sensor(s)" in subsystem Bacterial hemoglobins

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165KD12 at UniProt or InterPro

Protein Sequence (894 amino acids)

>Ac3H11_1725 diguanylate cyclase/phosphodiesterase (GGDEF & EAL domains) with PAS/PAC sensor(s) (Acidovorax sp. GW101-3H11)
MREPITPLRIKAFVGAAVVVFVVAVAIVAAAVAWNARKVALNDSEAQATRFVAGAEAALN
RSLLTVDVLLASMDELLNLSNMTAPWLDAESASQRLRGSTRQNLMVRYVALLDTTGKTMA
SSDPAGGALAVQLPAGFLESVLEQSVSTLMVSAPVVSFASSERVLYFARHLRLADNTRVA
AVAELPVGALSAVLLQGVDISGLQVTLERAGGQLLLGVPGREEVIAPTLAPPLAELADLG
QEWKAPARLTGAPALVVFRPILYQDLRISASIPLHEALSSWRDQRDAIGLTALVFVAMIL
AAGGLAFRYLDRLSQARVAIAQSKATLDQALESMVSGFLLLDKNNCVVQWNSQFEVIFPW
LRGIVAPRLPFRAVIEETVKHHHPRLADEEHARWVEQRLLRQKQPQNEPHEQVFSNGRTI
QITERPTPDGGLVISYHDVTALRRASAEIENLAFYDPLTNLPNRRLLMDRMQQAIASSAR
SGQYGALLFLDLDHFKTLNDTRGHEVGDMLLRQVAQRLKTCVRREDTVARLGGDEFVVML
SDLSASSEEAGAHVRRVGEKILRKLNVPYTLGGHAHHSTPSIGATLMGGAIQSSVDLLKQ
ADIAMYQVKSQGRNALCFFDPQMQISISLRAQLEADLQAALTARQFVLHYQPQFHLDGRM
VGAEGLIRWQHPERGLVAPGAFIGVAEESELIVPMGHWVLRTACEQLAAWQGNPRLQHLQ
LSVNVSARQFRQRDFVARVVEVLRETGARPHLLKLELTESLVLDNVDDTIAKIGTLKTKG
VRFSVDDFGTGYSSLAYLTRLPLDQLKIDQSFVHNLGVRHTDDVIVQTILGMARNLELDV
IAEGVETEAQKKLLAQYGCTYFQGYLMGRPVPVAELEALLEPVTTTAEDIDLPS